PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 106aa    MW: 11967.9 Da    PI: 9.3753
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25555genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl
         EMT25555 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.561965IPR017930Myb domain
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-171461IPR001005SANT/Myb domain
SuperFamilySSF466896.15E-231590IPR009057Homeodomain-like
CDDcd001671.80E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.8E-76591IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNSMS TTACHIFPPL IGQYAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-14129325105MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0093121e-145BT009312.1 Triticum aestivum clone wlm1.pk0027.a5:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482590.11e-59PREDICTED: myb-related protein 306-like
RefseqXP_006658859.19e-60PREDICTED: transcription factor MYB30-like
SwissprotP813921e-56MYB06_ANTMA; Myb-related protein 306
TrEMBLM8BKN87e-76M8BKN8_AEGTA; Myb-related protein 306
STRINGOB07G28650.14e-60(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.15e-59myb domain protein 94